CDC37 polyclonal antibody
  • CDC37 polyclonal antibody

CDC37 polyclonal antibody

Ref: AB-PAB30657
CDC37 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CDC37.
Información adicional
Size 100 uL
Gene Name CDC37
Gene Alias P50CDC37
Gene Description cell division cycle 37 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq DGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVHLVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTKIKTADRQYMEGFNDELEAFKERV
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CDC37.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 11140
Iso type IgG

Enviar un mensaje


CDC37 polyclonal antibody

CDC37 polyclonal antibody