EPS8 polyclonal antibody
  • EPS8 polyclonal antibody

EPS8 polyclonal antibody

Ref: AB-PAB30649
EPS8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EPS8.
Información adicional
Size 100 uL
Gene Name EPS8
Gene Alias -
Gene Description epidermal growth factor receptor pathway substrate 8
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PKEQFIPPYVPRFRNGWEPPMLNFMGATMEQDLYQLAESVANVAEHQRKQEIKRLSTEHSSVSEYHPADGYAFSSNIYTRGSHLDQGEAAVAFKPTSNRHIDRNYEPLKTQPKKYAKSKYDFVARNNSELSVLKDDILEILDD
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EPS8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2059
Iso type IgG

Enviar un mensaje


EPS8 polyclonal antibody

EPS8 polyclonal antibody