ZNF267 polyclonal antibody
  • ZNF267 polyclonal antibody

ZNF267 polyclonal antibody

Ref: AB-PAB30642
ZNF267 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ZNF267.
Información adicional
Size 100 uL
Gene Name ZNF267
Gene Alias HZF2
Gene Description zinc finger protein 267
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq WKREECEGHNGCYDEKTFKYDQFDESSVESLFHQQILSSCAKSYNFDQYRKVFTHSSLLNQQEEIDIWGKHHIYDKTSVLFRQVSTLNSYRNVFIGEKNYHCNNSEKTLNQSSSP
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ZNF267.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10308
Iso type IgG

Enviar un mensaje


ZNF267 polyclonal antibody

ZNF267 polyclonal antibody