RPLP0 polyclonal antibody
  • RPLP0 polyclonal antibody

RPLP0 polyclonal antibody

Ref: AB-PAB30624
RPLP0 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RPLP0.
Información adicional
Size 100 uL
Gene Name RPLP0
Gene Alias L10E|MGC111226|MGC88175|P0|PRLP0|RPP0
Gene Description ribosomal protein, large, P0
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RPLP0.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6175
Iso type IgG

Enviar un mensaje


RPLP0 polyclonal antibody

RPLP0 polyclonal antibody