LCK polyclonal antibody
  • LCK polyclonal antibody

LCK polyclonal antibody

Ref: AB-PAB30622
LCK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LCK.
Información adicional
Size 100 uL
Gene Name LCK
Gene Alias YT16|p56lck|pp58lck
Gene Description lymphocyte-specific protein tyrosine kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASPLQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKANSLEPEPWFFKNLSRKDAERQLLAPGNTHGS
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LCK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3932
Iso type IgG

Enviar un mensaje


LCK polyclonal antibody

LCK polyclonal antibody