ASB7 polyclonal antibody
  • ASB7 polyclonal antibody

ASB7 polyclonal antibody

Ref: AB-PAB30617
ASB7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ASB7.
Información adicional
Size 100 uL
Gene Name ASB7
Gene Alias FLJ22551
Gene Description ankyrin repeat and SOCS box-containing 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq HHHCRRNPELQEELQIQAAVAAGDVHTVRKMLEQGYSPNGRDANGWTLLHFSAARGKERCVRVFLEHGADPTVKDLIGGFTALHYAAMHGRARIARLMLESEYRSDIINAKSNDGWTPLHVAAHYGRDSFVRLLLEFKAEVDPLSDK
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ASB7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 140460
Iso type IgG

Enviar un mensaje


ASB7 polyclonal antibody

ASB7 polyclonal antibody