TOMM70A polyclonal antibody
  • TOMM70A polyclonal antibody

TOMM70A polyclonal antibody

Ref: AB-PAB30601
TOMM70A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TOMM70A.
Información adicional
Size 100 uL
Gene Name TOMM70A
Gene Alias FLJ90470
Gene Description translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB,IHC-P,IF
Immunogen Prot. Seq PLLSTQDFNMAADIDPQNADVYHHRGQLKILLDQVEEAVADFDECIRLRPESALAQAQKCFALYRQAYTGNNSSQIQAAMKGFEEVIKKFPRCAEGYALYAQALTDQQQFGKADEMYDKCIDLEPDNATT
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 383-512 of human TOMM70A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9868
Iso type IgG

Enviar un mensaje


TOMM70A polyclonal antibody

TOMM70A polyclonal antibody