MAP2 polyclonal antibody
  • MAP2 polyclonal antibody

MAP2 polyclonal antibody

Ref: AB-PAB30594
MAP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human MAP2.
Información adicional
Size 100 uL
Gene Name MAP2
Gene Alias DKFZp686I2148|MAP2A|MAP2B|MAP2C
Gene Description microtubule-associated protein 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq EAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVT
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 8-148 of human MAP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4133
Iso type IgG

Enviar un mensaje


MAP2 polyclonal antibody

MAP2 polyclonal antibody