FGF3 polyclonal antibody
  • FGF3 polyclonal antibody

FGF3 polyclonal antibody

Ref: AB-PAB30592
FGF3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human FGF3.
Información adicional
Size 100 uL
Gene Name FGF3
Gene Alias HBGF-3|INT2
Gene Description fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq RGRLYASEHYSAECEFVERIHELGYNTYASRLYRTVSSTPGARRQPSAERLWYVSVNGKGRPRRGFKTRRTQKSSLFLPRVLDHRDHEMVRQLQSGLPRPPGKGVQPRRRRQKQSPDNLEPS
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 102-223 of human FGF3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 2248
Iso type IgG

Enviar un mensaje


FGF3 polyclonal antibody

FGF3 polyclonal antibody