PTPN1 polyclonal antibody
  • PTPN1 polyclonal antibody

PTPN1 polyclonal antibody

Ref: AB-PAB30588
PTPN1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTPN1.
Información adicional
Size 100 uL
Gene Name PTPN1
Gene Alias PTP1B
Gene Description protein tyrosine phosphatase, non-receptor type 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq RFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYW
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:250 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 268-406 of human PTPN1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5770
Iso type IgG

Enviar un mensaje


PTPN1 polyclonal antibody

PTPN1 polyclonal antibody