LRP4 polyclonal antibody
  • LRP4 polyclonal antibody

LRP4 polyclonal antibody

Ref: AB-PAB30585
LRP4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LRP4.
Información adicional
Size 100 uL
Gene Name LRP4
Gene Alias KIAA0816|LRP10|MEGF7
Gene Description low density lipoprotein receptor-related protein 4
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq IQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASDFVCACPDEPDSQPCSLVPGLVPPAPRATGMSEKSPVLPNTPPTTLYSSTTRTRTSLEEVEGRCSERDARLGLCARSNDAVPAAP
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 1579-1718 of human LRP4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 4038
Iso type IgG

Enviar un mensaje


LRP4 polyclonal antibody

LRP4 polyclonal antibody