RNF149 polyclonal antibody
  • RNF149 polyclonal antibody

RNF149 polyclonal antibody

Ref: AB-PAB30580
RNF149 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human RNF149.
Información adicional
Size 100 uL
Gene Name RNF149
Gene Alias DNAPTP2|FLJ90504
Gene Description ring finger protein 149
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq LLLHTVKHGEKGIDVDAENCAVCIENFKVKDIIRILPCKHIFHRICIDPWLLDHRTCPMCKLDVIKALGYWGEPGDVQEMPAPESPPGRDPAANLSLALPDDDGSDESSPPSASPAESEPQCDPSFKGDAGENT
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 250-383 of human RNF149.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 284996
Iso type IgG

Enviar un mensaje


RNF149 polyclonal antibody

RNF149 polyclonal antibody