PHF2 polyclonal antibody
  • PHF2 polyclonal antibody

PHF2 polyclonal antibody

Ref: AB-PAB30578
PHF2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PHF2.
Información adicional
Size 100 uL
Gene Name PHF2
Gene Alias GRC5|JHDM1E|KIAA0662|MGC176680
Gene Description PHD finger protein 2
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LEIREQTKSKSEAKWKYKNSKPDSLLKMEEEQKLEKSPLAGNKDNKFSFSFSNKKLLGSKALRPPTSPGVFGALQNFKEDKPKPVRDEYEYVSDDGELKIDEFPIRRKKNAPKRDLSFLLDKKAVLPTPVTKPKLD
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 589-724 of human PHF2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5253
Iso type IgG

Enviar un mensaje


PHF2 polyclonal antibody

PHF2 polyclonal antibody