BMF polyclonal antibody
  • BMF polyclonal antibody

BMF polyclonal antibody

Ref: AB-PAB30575
BMF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BMF.
Información adicional
Size 100 uL
Gene Name BMF
Gene Alias FLJ00065
Gene Description Bcl2 modifying factor
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq VEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCIADQFHRLHVQQHQQNQ
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 7-156 of human BMF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 90427
Iso type IgG

Enviar un mensaje


BMF polyclonal antibody

BMF polyclonal antibody