THRA polyclonal antibody
  • THRA polyclonal antibody

THRA polyclonal antibody

Ref: AB-PAB30572
THRA polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human THRA.
Información adicional
Size 100 uL
Gene Name THRA
Gene Alias AR7|EAR7|ERB-T-1|ERBA|ERBA1|MGC000261|MGC43240|NR1A1|THRA1|THRA2|c-ERBA-1
Gene Description thyroid hormone receptor, alpha (erythroblastic leukemia viral (v-erb-a) oncogene homolog, avian)
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P,IF
Immunogen Prot. Seq AFEHYVNHRKHNIPHFWPKLLMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLQGPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSE
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50 - 1:200)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 348-466 of human THRA.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 7067
Iso type IgG

Enviar un mensaje


THRA polyclonal antibody

THRA polyclonal antibody