HSF1 polyclonal antibody
  • HSF1 polyclonal antibody

HSF1 polyclonal antibody

Ref: AB-PAB30566
HSF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HSF1.
Información adicional
Size 100 uL
Gene Name HSF1
Gene Alias HSTF1
Gene Description heat shock transcription factor 1
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq SNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVFDQGQFAKEVLPKYFKHNNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVTSVSTLKSEDIKIRQDSVTKLLTDVQLMKGKQECMDSKLLA
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200 - 1:500)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 13-160 of human HSF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3297
Iso type IgG

Enviar un mensaje


HSF1 polyclonal antibody

HSF1 polyclonal antibody