DPP8 polyclonal antibody
  • DPP8 polyclonal antibody

DPP8 polyclonal antibody

Ref: AB-PAB30561
DPP8 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DPP8.
Información adicional
Size 100 uL
Gene Name DPP8
Gene Alias DP8|DPRP1|FLJ14920|FLJ20283|MGC26191|MSTP141
Gene Description dipeptidyl-peptidase 8
Storage Conditions Store at 4C for short term storage. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq MAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQLKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPKTINRAAVLMLSWKPL
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
Western Blot (1:100 - 1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 17-135 of human DPP8.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 54878
Iso type IgG

Enviar un mensaje


DPP8 polyclonal antibody

DPP8 polyclonal antibody