DAP polyclonal antibody
  • DAP polyclonal antibody

DAP polyclonal antibody

Ref: AB-PAB30554
DAP polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human DAP.
Información adicional
Size 100 uL
Gene Name DAP
Gene Alias MGC99796
Gene Description death-associated protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq QFRPNPTLLGNLRQNQVLCPLPYISIFKTRNSSSPNLVYGESGWMSFEDHCAPRGAISRICQDPRKILALVLFQQSP
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DAP.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 1611
Iso type IgG

Enviar un mensaje


DAP polyclonal antibody

DAP polyclonal antibody