STAT2 polyclonal antibody
  • STAT2 polyclonal antibody

STAT2 polyclonal antibody

Ref: AB-PAB30553
STAT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human STAT2.
Información adicional
Size 100 uL
Gene Name STAT2
Gene Alias ISGF-3|MGC59816|P113|STAT113
Gene Description signal transducer and activator of transcription 2, 113kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human STAT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6773
Iso type IgG

Enviar un mensaje


STAT2 polyclonal antibody

STAT2 polyclonal antibody