KPNA6 polyclonal antibody
  • KPNA6 polyclonal antibody

KPNA6 polyclonal antibody

Ref: AB-PAB30551
KPNA6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human KPNA6.
Información adicional
Size 100 uL
Gene Name KPNA6
Gene Alias FLJ11249|IPOA7|KPNA7|MGC17918
Gene Description karyopherin alpha 6 (importin alpha 7)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq RRREEEGIQLRKQKREQQLFKRRNVELINEEAAMFDSLLMDSYVSSTTGESVITREMVEMLFSDDSDLQLATTQKFR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human KPNA6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23633
Iso type IgG

Enviar un mensaje


KPNA6 polyclonal antibody

KPNA6 polyclonal antibody