PDCD5 polyclonal antibody
  • PDCD5 polyclonal antibody

PDCD5 polyclonal antibody

Ref: AB-PAB30545
PDCD5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human PDCD5.
Información adicional
Size 100 uL
Gene Name PDCD5
Gene Alias MGC9294|TFAR19
Gene Description programmed cell death 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PDCD5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9141
Iso type IgG

Enviar un mensaje


PDCD5 polyclonal antibody

PDCD5 polyclonal antibody