SRPK2 polyclonal antibody
  • SRPK2 polyclonal antibody

SRPK2 polyclonal antibody

Ref: AB-PAB30538
SRPK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human SRPK2.
Información adicional
Size 100 uL
Gene Name SRPK2
Gene Alias FLJ36101|SFRSK2
Gene Description SFRS protein kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,IHC-P,IF
Immunogen Prot. Seq QQLDDEDDDEEDCPNPEEYNLDEPNAESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQEESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
Western Blot (1:100-1:250)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SRPK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 6733
Iso type IgG

Enviar un mensaje


SRPK2 polyclonal antibody

SRPK2 polyclonal antibody