RELB polyclonal antibody
  • RELB polyclonal antibody

RELB polyclonal antibody

Ref: AB-PAB30535
RELB polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant human RELB.
Información adicional
Size 100 uL
Gene Name RELB
Gene Alias I-REL|IREL
Gene Description v-rel reticuloendotheliosis viral oncogene homolog B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq WKDWPHRVHPHSLVGKDCTDGICRVRLRPHVSPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRDQQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human RELB.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 5971
Iso type IgG

Enviar un mensaje


RELB polyclonal antibody

RELB polyclonal antibody