SIK2 polyclonal antibody
  • SIK2 polyclonal antibody

SIK2 polyclonal antibody

Ref: AB-PAB30514
SIK2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SIK2.
Información adicional
Size 100 uL
Gene Name SIK2
Gene Alias DKFZp434K1115|KIAA0781|LOH11CR1I|QIK|SNF1LK2
Gene Description salt-inducible kinase 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq HFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTIAEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDTPKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLE
Form Liquid
Recomended Dilution Immunofluorescence (1 - 4 ug/mL)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20 - 1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids 325 - 457 of human SIK2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 23235
Iso type IgG

Enviar un mensaje


SIK2 polyclonal antibody

SIK2 polyclonal antibody