EMR3 polyclonal antibody
  • EMR3 polyclonal antibody

EMR3 polyclonal antibody

Ref: AB-PAB30504
EMR3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human EMR3.
Información adicional
Size 100 uL
Gene Name EMR3
Gene Alias -
Gene Description egf-like module containing, mucin-like, hormone receptor-like 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NASCVNNTHCTCNHGYTSGSGQKLFTFPLETCNDINECTPPYSVYCGFNAVCYNVEGSFYCQCVPGYRLHSGNEQFSNSNENTCQDTTSSKTTEGRKELQKIVDKFESLLTNQTLWRTEGRQEISSTATTILRDVESKVL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human EMR3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84658
Iso type IgG

Enviar un mensaje


EMR3 polyclonal antibody

EMR3 polyclonal antibody