IL1RL2 polyclonal antibody
  • IL1RL2 polyclonal antibody

IL1RL2 polyclonal antibody

Ref: AB-PAB30498
IL1RL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human IL1RL2.
Información adicional
Size 100 uL
Gene Name IL1RL2
Gene Alias IL1R-rp2|IL1RRP2
Gene Description interleukin 1 receptor-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQLGTTLIVDCNVTDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNITFLEVKMEDYGLPFMCHAG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human IL1RL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8808
Iso type IgG

Enviar un mensaje


IL1RL2 polyclonal antibody

IL1RL2 polyclonal antibody