SLC37A2 polyclonal antibody
  • SLC37A2 polyclonal antibody

SLC37A2 polyclonal antibody

Ref: AB-PAB30493
SLC37A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLC37A2.
Información adicional
Size 100 uL
Gene Name SLC37A2
Gene Alias FLJ00171|MGC71430|pp11662
Gene Description solute carrier family 37 (glycerol-3-phosphate transporter), member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RKPISIVKSRLHQNCSEQIKPINDTHSLNDTMWCSWAPFDKDNYKE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLC37A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 219855
Iso type IgG

Enviar un mensaje


SLC37A2 polyclonal antibody

SLC37A2 polyclonal antibody