BMP1 polyclonal antibody
  • BMP1 polyclonal antibody

BMP1 polyclonal antibody

Ref: AB-PAB30488
BMP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human BMP1.
Información adicional
Size 100 uL
Gene Name BMP1
Gene Alias FLJ44432|PCOLC|PCP|TLD|pCP-2
Gene Description bone morphogenetic protein 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DSEPLNYKDPCKAAAFLGDIALDEEDLRAFQVQQAVDLRRHTARKSSIKAAVPGNTSTPSCQSTNGQPQRGACGRWRGRSRSRRAATSRPERVWPDGVIPFVIGGNFTGS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human BMP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 649
Iso type IgG

Enviar un mensaje


BMP1 polyclonal antibody

BMP1 polyclonal antibody