SLITRK6 polyclonal antibody
  • SLITRK6 polyclonal antibody

SLITRK6 polyclonal antibody

Ref: AB-PAB30485
SLITRK6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SLITRK6.
Información adicional
Size 100 uL
Gene Name SLITRK6
Gene Alias MGC119595|MGC119596|MGC119597
Gene Description SLIT and NTRK-like family, member 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq HHTTERPSASLYEQHMVSPMVHVYRSPSFGPKHLEEEEERNEKEGSDAKHLQRSLLEQENHSPLTGSNMKYKTTNQSTEFLSFQDASSLYRNILEKERELQQLGITEYLRKNIAQLQPDMEAHYPGAHEELKLMETLMYSRPRKVLV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SLITRK6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 84189
Iso type IgG

Enviar un mensaje


SLITRK6 polyclonal antibody

SLITRK6 polyclonal antibody