HCRTR1 polyclonal antibody
  • HCRTR1 polyclonal antibody

HCRTR1 polyclonal antibody

Ref: AB-PAB30478
HCRTR1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HCRTR1.
Información adicional
Size 100 uL
Gene Name HCRTR1
Gene Alias OX1R
Gene Description hypocretin (orexin) receptor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HCRTR1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3061
Iso type IgG

Enviar un mensaje


HCRTR1 polyclonal antibody

HCRTR1 polyclonal antibody