CELSR2 polyclonal antibody
  • CELSR2 polyclonal antibody

CELSR2 polyclonal antibody

Ref: AB-PAB30476
CELSR2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CELSR2.
Información adicional
Size 100 uL
Gene Name CELSR2
Gene Alias CDHF10|EGFL2|FLJ34118|FLJ42737|FLJ45143|FLJ45845|Flamingo1|KIAA0279|MEGF3
Gene Description cadherin, EGF LAG seven-pass G-type receptor 2 (flamingo homolog, Drosophila)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SATQDVHFTENLLRVGSALLDTANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGEQPPDLETTVILPESVFRETPPVVRPAGPGEAQEPEELARRQRRHPELSQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CELSR2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1952
Iso type IgG

Enviar un mensaje


CELSR2 polyclonal antibody

CELSR2 polyclonal antibody