TNFSF15 polyclonal antibody
  • TNFSF15 polyclonal antibody

TNFSF15 polyclonal antibody

Ref: AB-PAB30461
TNFSF15 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human TNFSF15.
Información adicional
Size 100 uL
Gene Name TNFSF15
Gene Alias MGC129934|MGC129935|TL1|TL1A|VEGI|VEGI192A
Gene Description tumor necrosis factor (ligand) superfamily, member 15
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human TNFSF15.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 9966
Iso type IgG

Enviar un mensaje


TNFSF15 polyclonal antibody

TNFSF15 polyclonal antibody