LGR5 polyclonal antibody
  • LGR5 polyclonal antibody

LGR5 polyclonal antibody

Ref: AB-PAB30456
LGR5 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human LGR5.
Información adicional
Size 100 uL
Gene Name LGR5
Gene Alias FEX|GPR49|GPR67|GRP49|HG38|MGC117008
Gene Description leucine-rich repeat-containing G protein-coupled receptor 5
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human LGR5.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 8549
Iso type IgG

Enviar un mensaje


LGR5 polyclonal antibody

LGR5 polyclonal antibody