POSTN polyclonal antibody
  • POSTN polyclonal antibody

POSTN polyclonal antibody

Ref: AB-PAB30452
POSTN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human POSTN.
Información adicional
Size 100 uL
Gene Name POSTN
Gene Alias MGC119510|MGC119511|OSF-2|PDLPOSTN|PN|RP11-412K4.1|periostin
Gene Description periostin, osteoblast specific factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human POSTN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10631
Iso type IgG

Enviar un mensaje


POSTN polyclonal antibody

POSTN polyclonal antibody