DKK3 polyclonal antibody
  • DKK3 polyclonal antibody

DKK3 polyclonal antibody

Ref: AB-PAB30447
DKK3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DKK3.
Información adicional
Size 100 uL
Gene Name DKK3
Gene Alias REIC
Gene Description dickkopf homolog 3 (Xenopus laevis)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq CGDQLCVWGHCTKMATRGSNGTICDNQRDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLVYVCKPTFVGSRDQDGEILLPREVPDEYLAASW
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DKK3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 27122
Iso type IgG

Enviar un mensaje


DKK3 polyclonal antibody

DKK3 polyclonal antibody