PTPRR polyclonal antibody
  • PTPRR polyclonal antibody

PTPRR polyclonal antibody

Ref: AB-PAB30446
PTPRR polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTPRR.
Información adicional
Size 100 uL
Gene Name PTPRR
Gene Alias DKFZp781C1038|EC-PTP|FLJ34328|MGC131968|MGC148170|PCPTP1|PTP-SL|PTPBR7|PTPRQ
Gene Description protein tyrosine phosphatase, receptor type, R
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq YDPSLNLLAMDGQDLEVENLPIPAANVIVVTLQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDALPSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PTPRR.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 5801
Iso type IgG

Enviar un mensaje


PTPRR polyclonal antibody

PTPRR polyclonal antibody