CHST9 polyclonal antibody
  • CHST9 polyclonal antibody

CHST9 polyclonal antibody

Ref: AB-PAB30445
CHST9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CHST9.
Información adicional
Size 100 uL
Gene Name CHST9
Gene Alias GALNAC4ST-2
Gene Description carbohydrate (N-acetylgalactosamine 4-0) sulfotransferase 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TGRVEKRREQKVTSGWGPVKYLRPVPRIMSTEKIQEHITNQNPKFHMPEDVREKKENLLLNSERSTRLLTKTSHSQGGDQALSKSTGSPTEKLIEKRQGAKTVFNKFSNMNWPVDIHPLNKSLVKDNKWKKTE
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CHST9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 83539
Iso type IgG

Enviar un mensaje


CHST9 polyclonal antibody

CHST9 polyclonal antibody