APPL1 polyclonal antibody
  • APPL1 polyclonal antibody

APPL1 polyclonal antibody

Ref: AB-PAB30442
APPL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human APPL1.
Información adicional
Size 100 uL
Gene Name APPL1
Gene Alias APPL|DIP13alpha
Gene Description adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human APPL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 26060
Iso type IgG

Enviar un mensaje


APPL1 polyclonal antibody

APPL1 polyclonal antibody