ALCAM polyclonal antibody
  • ALCAM polyclonal antibody

ALCAM polyclonal antibody

Ref: AB-PAB30438
ALCAM polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ALCAM.
Información adicional
Size 100 uL
Gene Name ALCAM
Gene Alias CD166|FLJ38514|MEMD|MGC71733
Gene Description activated leukocyte cell adhesion molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ALCAM.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 214
Iso type IgG

Enviar un mensaje


ALCAM polyclonal antibody

ALCAM polyclonal antibody