CD1A polyclonal antibody
  • CD1A polyclonal antibody

CD1A polyclonal antibody

Ref: AB-PAB30436
CD1A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CD1A.
Información adicional
Size 100 uL
Gene Name CD1A
Gene Alias CD1|FCB6|HTA1|R4|T6
Gene Description CD1a molecule
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QNLVSGWLSDLQTHTWDSNSSTIVFLCPWSRGNFSNEEWKELETLFRIRTIRSFEGIRRYAHELQFEYPFEIQVTGGCELHSGKVSGSFLQLAYQGSDFVSFQNNSWLPYPVAGNMAKHFCKVLNQNQHEND
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CD1A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 909
Iso type IgG

Enviar un mensaje


CD1A polyclonal antibody

CD1A polyclonal antibody