ALPL polyclonal antibody
  • ALPL polyclonal antibody

ALPL polyclonal antibody

Ref: AB-PAB30402
ALPL polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ALPL.
Información adicional
Size 100 uL
Gene Name ALPL
Gene Alias AP-TNAP|FLJ40094|FLJ93059|HOPS|MGC161443|MGC167935|TNAP|TNSALP
Gene Description alkaline phosphatase, liver/bone/kidney
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ALPL.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 249
Iso type IgG

Enviar un mensaje


ALPL polyclonal antibody

ALPL polyclonal antibody