SDC4 polyclonal antibody
  • SDC4 polyclonal antibody

SDC4 polyclonal antibody

Ref: AB-PAB30394
SDC4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human SDC4.
Información adicional
Size 100 uL
Gene Name SDC4
Gene Alias MGC22217|SYND4
Gene Description syndecan 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human SDC4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 6385
Iso type IgG

Enviar un mensaje


SDC4 polyclonal antibody

SDC4 polyclonal antibody