HTR1F polyclonal antibody
  • HTR1F polyclonal antibody

HTR1F polyclonal antibody

Ref: AB-PAB30393
HTR1F polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HTR1F.
Información adicional
Size 100 uL
Gene Name HTR1F
Gene Alias 5-HT1F|5HT6|HTR1EL|MR77
Gene Description 5-hydroxytryptamine (serotonin) receptor 1F
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HTR1F.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3355
Iso type IgG

Enviar un mensaje


HTR1F polyclonal antibody

HTR1F polyclonal antibody