CHI3L2 polyclonal antibody
  • CHI3L2 polyclonal antibody

CHI3L2 polyclonal antibody

Ref: AB-PAB30391
CHI3L2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human CHI3L2.
Información adicional
Size 100 uL
Gene Name CHI3L2
Gene Alias YKL-39|YKL39
Gene Description chitinase 3-like 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq IDPFLCSHLIYSFASIENNKVIIKDKSEVMLYQTINSLKTKNPKLKILLSIGGYLFGSKGFHPMVDSSTSRLEFINSIILFLRNHNFDGLDVSWIYPDQKENTHFTVLIHELAEAFQKDFTKSTKER
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human CHI3L2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1117
Iso type IgG

Enviar un mensaje


CHI3L2 polyclonal antibody

CHI3L2 polyclonal antibody