PTPN22 polyclonal antibody
  • PTPN22 polyclonal antibody

PTPN22 polyclonal antibody

Ref: AB-PAB30385
PTPN22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human PTPN22.
Información adicional
Size 100 uL
Gene Name PTPN22
Gene Alias LYP|Lyp1|Lyp2|PEP|PTPN8
Gene Description protein tyrosine phosphatase, non-receptor type 22 (lymphoid)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SEISAKEELVLHPAKSSTSFDFLELNYSFDKNADTTMKWQTKAFPIVGEPLQKHQSLDLGSLLFEGCSNSKPVNAAGRYFNSKVPITRTKS
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human PTPN22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 26191
Iso type IgG

Enviar un mensaje


PTPN22 polyclonal antibody

PTPN22 polyclonal antibody