ITGAV polyclonal antibody
  • ITGAV polyclonal antibody

ITGAV polyclonal antibody

Ref: AB-PAB30382
ITGAV polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGAV.
Información adicional
Size 100 uL
Gene Name ITGAV
Gene Alias CD51|DKFZp686A08142|MSK8|VNRA
Gene Description integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq DHLITKRDLALSEGDIHTLGCGVAQCLKIVCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDITNSTLVTTNVTWG
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITGAV.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3685
Iso type IgG

Enviar un mensaje


ITGAV polyclonal antibody

ITGAV polyclonal antibody