ITGAX polyclonal antibody
  • ITGAX polyclonal antibody

ITGAX polyclonal antibody

Ref: AB-PAB30376
ITGAX polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human ITGAX.
Información adicional
Size 100 uL
Gene Name ITGAX
Gene Alias CD11C|SLEB6
Gene Description integrin, alpha X (complement component 3 receptor 4 subunit)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRV
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human ITGAX.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 3687
Iso type IgG

Enviar un mensaje


ITGAX polyclonal antibody

ITGAX polyclonal antibody