AUH polyclonal antibody
  • AUH polyclonal antibody

AUH polyclonal antibody

Ref: AB-PAB30369
AUH polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human AUH.
Información adicional
Size 100 uL
Gene Name AUH
Gene Alias -
Gene Description AU RNA binding protein/enoyl-Coenzyme A hydratase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SAWLCPGLRLPGSLAGRRAGPAIWAQGWVPAAGGPAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNSLSKNLIKMLSKAVDALKSDKK
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human AUH.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 549
Iso type IgG

Enviar un mensaje


AUH polyclonal antibody

AUH polyclonal antibody