DYNC1H1 polyclonal antibody
  • DYNC1H1 polyclonal antibody

DYNC1H1 polyclonal antibody

Ref: AB-PAB30356
DYNC1H1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human DYNC1H1.
Información adicional
Size 100 uL
Gene Name DYNC1H1
Gene Alias DHC1|DHC1a|DKFZp686P2245|DNCH1|DNCL|DNECL|DYHC|Dnchc1|HL-3|KIAA0325|p22
Gene Description dynein, cytoplasmic 1, heavy chain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RSLETCMYDHKTFSEILNRVQKAVDDLNLHSYSNLPIWVNKLDMEIERILGVRLQAGLRAWTQVLLGQAEDKAEVDMDTDAPQVSHKPGGEPKIKNVVHELRITNQVIYLNPPIEECRYKLYQEMFAWKMVVLSLPRIQSQR
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human DYNC1H1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 1778
Iso type IgG

Enviar un mensaje


DYNC1H1 polyclonal antibody

DYNC1H1 polyclonal antibody