HDAC6 polyclonal antibody
  • HDAC6 polyclonal antibody

HDAC6 polyclonal antibody

Ref: AB-PAB30352
HDAC6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against partial recombinant human HDAC6.
Información adicional
Size 100 uL
Gene Name HDAC6
Gene Alias FLJ16239|HD6|JM21
Gene Description histone deacetylase 6
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCHSAEYVGHL
Form Liquid
Recomended Dilution Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to human HDAC6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide).
Gene ID 10013
Iso type IgG

Enviar un mensaje


HDAC6 polyclonal antibody

HDAC6 polyclonal antibody